PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.B00245.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family M-type_MADS
Protein Properties Length: 410aa    MW: 45448.8 Da    PI: 6.5136
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.B00245.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF42.96.1e-141258349
                    --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
          SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                    +en+snr++tf kRr+g+ K A  LS+L++a++a+ + s+ gk+  +
  Pahal.B00245.1 12 VENDSNRSITFFKRRAGLYKAAADLSTLTGARIAMALESEIGKMSSF 58
                    79*****************************************9887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-12161IPR002100Transcription factor, MADS-box
PROSITE profilePS5006617.03262IPR002100Transcription factor, MADS-box
PRINTSPR004047.4E-9424IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.88E-15572IPR002100Transcription factor, MADS-box
PfamPF003193.7E-151258IPR002100Transcription factor, MADS-box
PRINTSPR004047.4E-92439IPR002100Transcription factor, MADS-box
PRINTSPR004047.4E-93960IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 410 aa     Download sequence    Send to blast
MTRPRRSGIS YVENDSNRSI TFFKRRAGLY KAAADLSTLT GARIAMALES EIGKMSSFGT  60
PSAGPIIDSF LSGNIPVDPS VNEEKKGEIT HLQNEVFMAE KEKYMEDRRK QETSARAKEI  120
QETSRKAKLV YGKVEDLSVE ELNEMVHDLS QIEQEINDGR HPQQPSYIEV GGSRDPFLGR  180
LSSSSSRSQI QMPPRRLPWT PRQPSLHLPR SSWSLPQPSR SQSSLLNPSL LPSAQAQPRP  240
LFQHNLMLQY PSVVEPQVQM MLSPTETYQH NYNTQLGMHI NGNMSQPFSQ SFLTSALPPP  300
PPSSSAQITL CNEFPPPSSS HEPPTPLPKE TELHPVEQSE NHASAQDITI GHSFVNHHWP  360
SPISSNEPFY DISLYRMNLN LGGHGDYGGQ AVGEHDMPGP SGLHQQGTS*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004958932.11e-150PREDICTED: uncharacterized protein LOC101780877
TrEMBLK4A1W61e-170K4A1W6_SETIT; Uncharacterized protein
STRINGSi032862m1e-169(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30892276
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.11e-14AGAMOUS-like 61